PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23811.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 307aa    MW: 33905.2 Da    PI: 7.3256
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23811.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.48.5e-32139195158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVNaKQyq+Il+RRq+Rak+e ekkl +k rkpylheSRh+hA+rR+Rg+gGrF
  KHN23811.1 139 QEPVYVNAKQYQGILRRRQARAKAELEKKL-IKVRKPYLHESRHQHAIRRARGNGGRF 195
                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-34137198IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.745138198IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.5E-27140195IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.4E-23141163IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860143163IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.4E-23172195IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MQSKSETANQ LRSDPRSFAP NQSYSEPWWR GIQCNPVPQA MSGVNISNSS SLERPNGDSE  60
SSEEDDDATK EPQPTAPNQS GNYGQDYQAL QHSSSSAPLV RDDCLTQAPQ LELVGHSIGY  120
APFIGMPHAR MALPLEMAQE PVYVNAKQYQ GILRRRQARA KAELEKKLIK VRKPYLHESR  180
HQHAIRRARG NGGRFAKKTE VEASNHMNEE KDMGTGQVPL SRSISSSGFG SLPSDSAETW  240
NSPSVQQGAR GSQVHERFEE RNYANVLQSS STSCLHSGER AEEGDCSGQQ RGSISSEHTS  300
QRRLAIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-19139209271NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0954570.0BT095457.1 Soybean clone JCVI-FLGm-25M11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003544525.10.0PREDICTED: nuclear transcription factor Y subunit A-9 isoform X1
SwissprotQ945M91e-59NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A0B2QQJ80.0A0A0B2QQJ8_GLYSO; Nuclear transcription factor Y subunit A-9
STRINGGLYMA14G01360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40123461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-55nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]